Sermorelin CAS 86168-78-7 Sermorelin Acetate 2MG for Weight Loss
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Usage xanthine oxidase inhibitor
Sermorelin Applications:
- Increases the development of lean body mass through the development of new muscle cells
- Reduces body fat through lipolysis
- Increases energy and vitality
- Increases strength
- Increases endurance
- Accelerates healing from wounds or surgery
- Strengthens the heart
- Enhances the immune system
- Increases IGF-1 production
- Improves sleep quality
- Increases calcium retention, and strengthens and increases the mineralization of bone or bone density.
- Increases protein synthesis and stimulates the growth of all internal organs except the brain.
The Sermorelin Acetate Peptide and HGH
Sermorelin Acetate, which shares similar structure to CJC-1295, is a bio-identical synthetic hormone that is extremely effective in increasing the amount of HGH. Human Growth Hormone is a hormone released by the body that controls the reproduction and growth of the cells and each of the organs in the body. At a young age, the body's HGH production is most active while the growth rate is at its highest point. After the age of 30, for every decade of life, there is a 14% reduction in HGH production . By the age of 40, HGH production is about 40 percent of what it was at the age of 20. With the further development of Growth Hormone Releasing Factors (GHRF), such as Modified GRF 1-29, HGH production may possibly begin again by stimulating the pituitary gland.
MGF, 2mg |
PEG MGF, 2mg |
CJC-1295 DAC, 2mg |
CJC-1295, 2mg |
PT141, 10mg |
Melanotan-2, 10mg |
GHRP-2, 10mg |
GHRP-6, 10mg |
GHRP-2, 5mg |
GHRP-6, 5mg |
Ipamorelin, 2mg |
Hexarelin, 2mg |
Sermorelin, 2mg |
Oxytocin, 2mg |
TB500, 2mg |
HGH 176-191, 2mg |
Triptorelin, 2mg |
Tesamorelin, 2mg |
Gonadorelin, 2mg |
Gonadorelin, 10mg |
DSIP, 2mg |
Selank, 5mg |
BPC 157, 2mg |
Epitalon, 10mg |
Follistatin 344, 1mg |
AOD-9604, 2mg |
Deslorelin, 20mg |
IGF-1 LR3, 0.1mg |
Follistatin 315, 1mg |
Dermorphin, 10mg |
Thymosin α1 Acetate, 10mg |
ACE 031, 1mg |
GDF-8, 1mg |